{"product_id":"proteintech-67203-1-ig","title":"Proteintech, 67203-1-Ig, DCC-Specific Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DCC-Specific (67203-1-Ig) by Proteintech is a Monoclonal antibody targeting DCC-Specific in WB, ELISA applications with reactivity to Human, Mouse samples\n67203-1-Ig targets DCC-Specific in WB, IF, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDCC, also named as IGDCC1, belongs to the immunoglobulin superfamily and DCC family. DCC is a receptor for netrin required for axon guidance. DCC plays a key role in the developing nervous system. Its association with UNC5 proteins may trigger signaling for axon repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand. DCC gene is a tumor suppressor gene. This antibody recognizes endogenous DCC with an apparent molecular weight of 180 kDa. As the predicted molecular mass of DCC is 158 kDa, the slower mobility is likely attributable to post-translational modification, perhaps by glycosylation at potential N-linked glycosylation sites (PMID: 7926722; 8044801).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag20569 Product name: Recombinant human DCC-Specific protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-364 aa of NM_005215 Sequence: AHLQVTGFQIKAFTALRFLSEPSDAVTMRGGNVLLDCSAESDRGVPVIKWKKDGIHLALGMDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEASLGDSGSIISRTAKVAVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDLTPIPGDSRVVVLPSGALQISRLQPGDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNVTDDDSGMYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECTVSGKPVPTVNW Predict reactive species\nFull Name: deleted in colorectal carcinoma\nCalculated Molecular Weight: 1447 aa, 158 kDa\nObserved Molecular Weight: 180 kDa\nGenBank Accession Number: NM_005215\nGene Symbol: DCC\nGene ID (NCBI): 1630\nRRID: AB_2882496\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P43146\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888039809193,"sku":"67203-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67203-1-ig","provider":"Iright","version":"1.0","type":"link"}