{"product_id":"proteintech-67206-1-ig","title":"Proteintech, 67206-1-Ig, SQLE Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SQLE (67206-1-Ig) by Proteintech is a Monoclonal antibody targeting SQLE in WB, IF\/ICC, ELISA applications with reactivity to human, rat, pig samples\n67206-1-Ig targets SQLE in WB, IF\/ICC, ELISA applications and shows reactivity with human, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HepG2 cells,  HSC-T6 cells,  L02 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSQLE, also named as ERG1, SE and SM, belongs to the squalene monooxygenase family. It catalyzes the first oxygenation step in cholesterol synthesis, acting on squalene before cyclization into the basic steroid structure. SQLE may serve as a flux-controlling enzyme beyond 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGR, considered as rate limiting). It is also posttranslationally regulated by cholesterol-dependent proteasomal degradation. SQLE is subject to feedback regulation via cholesterol-induced degradation, which depends on its lipid-sensing N terminal regulatory domain. Truncation of SQLE occurs during its endoplasmic reticulum-associated degradation and requires the proteasome, which partially degrades the SQLE N-terminus and eliminates cholesterol-sensing elements within this region. The MW of SQLE is about 50-64 kDa. (PMID:21356516, PMID: 28972164)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3266 Product name: Recombinant human SQLE protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 143-508 aa of BC017033 Sequence: SRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGLGDTVEGLDAQVVNGYMIHDQESKSEVQIPYPLSENNQVQSGRAFHHGRFIMSLRKAAMAEPNAKFIEGVVLQLLEEDDVVMGVQYKDKETGDIKELHAPLTVVADGLFSKFRKSLVSNKVSVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYMVEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKKRGVLLLGDAYNMRHPLTGGGMTVAFKDIKLWRKLLKGIPDLYDDAAIFEAKKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGECVAGPVGL Predict reactive species\nFull Name: squalene epoxidase\nCalculated Molecular Weight: 574 aa, 64 kDa\nObserved Molecular Weight: 50-64 kDa\nGenBank Accession Number: BC017033\nGene Symbol: SQLE\nGene ID (NCBI): 6713\nRRID: AB_2882499\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14534\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888033747113,"sku":"67206-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67206-1-ig","provider":"Iright","version":"1.0","type":"link"}