{"product_id":"proteintech-67256-1-ig","title":"Proteintech, 67256-1-Ig, CDK9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDK9 (67256-1-Ig) by Proteintech is a Monoclonal antibody targeting CDK9 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67256-1-Ig targets CDK9 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, T-47D cells,  HCT 116 cells,  A431 cells,  MOLT-4 cells,  TF-1 cells,  HSC-T6 cells,  ROS1728 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDK9(Cyclin-dependent kinase 9) is a member of the Cdc2-like family of kinases. Its cyclin partners are members of the family of cyclin T (T1, T2a and T2b) and cyclin K. The CDK9\/cyclin T complexes appear to be involved in regulating several physiological processes. CDK9 has also been described as the kinase of the TAK complex, which is homologous to the P-TEFb complex and involved in HIV replication. In addition, CDK9 seems to have an anti-apoptotic function in monocytes, that may be related to its control over differentiation of monocytes (PMID: 12432243). CDK9 has two isoforms with the molecular mass of 42 kDa and 55 kDa, and the relative abundance of Cdk9(42kDa) and Cdk9(55kDa) changes in different cell types (PMID: 12706900, 15780980).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29178 Product name: Recombinant human CDK9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-372 aa of BC001968 Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF Predict reactive species\nFull Name: cyclin-dependent kinase 9\nCalculated Molecular Weight: 372 aa, 43 kDa\nObserved Molecular Weight: 38-42 kDa, 55 kDa\nGenBank Accession Number: BC001968\nGene Symbol: CDK9\nGene ID (NCBI): 1025\nRRID: AB_3085038\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P50750\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888107540649,"sku":"67256-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67256-1-ig","provider":"Iright","version":"1.0","type":"link"}