{"product_id":"proteintech-67272-1-ig","title":"Proteintech, 67272-1-Ig, Granzyme K Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Granzyme K (67272-1-Ig) by Proteintech is a Monoclonal antibody targeting Granzyme K in IHC, IF-P, ELISA applications with reactivity to human samples\n67272-1-Ig targets Granzyme K in IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGranzymes are a family of serine proteases stored in granules inside cytotoxic cells of the immune system. There are five human granzymes (granzyme A (GrA), GrB, GrH, GrK and GrM) currently identified, whereas mice have ten known granzymes (GrA-G, GrK, GrM and GrN) (PMID:14499263). Human GrK was first discovered in 1988 after purification from human peripheral blood mononuclear cells. GrK is expressed by cytotoxic T lymphocytes, natural killer T cells (NKT), γδ T cells and CD56bright+ NK cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27297 Product name: Recombinant human GZMK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 85-215 aa of BC035802 Sequence: HSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSG Predict reactive species\nFull Name: granzyme K (granzyme 3; NK tryptase II)\nCalculated Molecular Weight: 29 kDa\nGenBank Accession Number: BC035802\nGene Symbol: GZMK\nGene ID (NCBI): 3003\nRRID: AB_2882541\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P49863\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888000716969,"sku":"67272-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67272-1-ig","provider":"Iright","version":"1.0","type":"link"}