{"product_id":"proteintech-67326-1-ig","title":"Proteintech, 67326-1-Ig, Arp5\/ACTR5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Arp5\/ACTR5 (67326-1-Ig) by Proteintech is a Monoclonal antibody targeting Arp5\/ACTR5 in WB, ELISA applications with reactivity to Human, mouse, rat, pig samples\n67326-1-Ig targets Arp5\/ACTR5 in WB, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, C2C12 cells,  pig skeletal muscle tissue,  rat skeletal muscle tissue,  HEK-293 cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nArp5 is a member of nuclear actin-related proteins (ARPs) that function as components of the chromatin- remodeling complex. Recently study reported that Arp5 regulates smooth muscle cell differentiation through interaction with myocardin (Myocd). Arp5 has been identified as negative regulator of Myocd, suppressing Myocd activity in the nucleus through tightly binding with Myocd RPEL motifs. Alternative splicing results in two variants of Arp5: a broadly expressed arp5-common, and a smooth muscle restricted arp5-sm. Expression of Arp5-sm protein is strongly suppressed in well-differentiated smooth muscle cells by partial messenger RNA decay and translational suppression. (24567363)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15976 Product name: Recombinant human ACTR5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 258-607 aa of BC038402 Sequence: EELHKWRCPDYYENNVHKMQLPFSSKLLGSTLTSEEKQERLQQQLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALIELNMDSPEELQSYIQKLSIAVEQAKQKILQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEETPGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPKDVQEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGEYLKEHCASNIYVPIRLPKQASRSSDAQASSKGSAAGGGGAGEQA Predict reactive species\nFull Name: ARP5 actin-related protein 5 homolog (yeast)\nCalculated Molecular Weight: 607 aa, 68 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC038402\nGene Symbol: ARP5\/ACTR5\nGene ID (NCBI): 79913\nRRID: AB_2882585\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9H9F9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888100233385,"sku":"67326-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67326-1-ig","provider":"Iright","version":"1.0","type":"link"}