{"product_id":"proteintech-67360-1-ig","title":"Proteintech, 67360-1-Ig, UGDH Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe UGDH (67360-1-Ig) by Proteintech is a Monoclonal antibody targeting UGDH in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n67360-1-Ig targets UGDH in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, rat brain tissue,  HeLa cells,  HepG2 cells,  HSC-T6 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUDP-glucose 6-dehydrogenase (UGDH) is a key enzyme in the uronic acid pathway, and converts UDP-glucose (UDP-Glc) to UDP-glucuronic acid (UDP-GlcA). UGDH is critical to the production of extracellular matrix components which are essential to the migration and connectivity of neurons early in human brain development. UDP-GlcA is an essential sugar nucleotide precursor and a key component in the synthesis and stepwise degradation of glycosaminoglycans (GAGs). The protein subunit migrates on SDS-PAGE at ~55 kDa. (PMID: 32175296, PMID: 21576248, PMID: 31243371).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29747 Product name: Recombinant human UGDH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-301 aa of BC022781 Sequence: MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQ Predict reactive species\nFull Name: UDP-glucose dehydrogenase\nCalculated Molecular Weight: 494 aa, 55 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC022781\nGene Symbol: UGDH\nGene ID (NCBI): 7358\nRRID: AB_2882612\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O60701\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888034664617,"sku":"67360-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67360-1-ig","provider":"Iright","version":"1.0","type":"link"}