{"product_id":"proteintech-67378-1-ig","title":"Proteintech, 67378-1-Ig, eqRFP630\/eqRFP611 Monoclonal antibody","description":"Size: 150ul\nThe eqRFP630\/eqRFP611 (67378-1-Ig) by Proteintech is a Monoclonal antibody targeting eqRFP630\/eqRFP611 in WB, ELISA applications with reactivity to recombinant protein samples\n67378-1-Ig targets eqRFP630\/eqRFP611 in WB, IF, ELISA applications and shows reactivity with recombinant protein samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: ag27669\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:100000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRed fluorescent proteins (RFPs) is a collective term referring to a heterogenous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages.\nThe original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm). \nWhen fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy. RFP611 and RFP 630 is a basic (constitutively fluorescent) red fluorescent protein derived from Entacmaea quadricolor.\nThis antibody is a mouse (IgG2b) monoclonal antibody raised against RFP (eqFP611), it can also recognize eqFP630.\nThis antibody does not recognize DsRed or mRFP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: recombinant protein\nCited Reactivity: human, mouse, yeast\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27669 Product name: Recombinant entacmaea quadricolor Red fluorescent protein protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-231 aa of Sequence: MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVTGVNFPSNGAVMQKKTKGWEPNTEMLYPADGGLRGYSQMALNVDGGGYLSCSFETTYRSKKTVENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL Predict reactive species\nFull Name: eqRFP630\/eqRFP611\nCalculated Molecular Weight: 26 kDa\nRRID: AB_2882625\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8ISF8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888338522281,"sku":"67378-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67378-1-ig","provider":"Iright","version":"1.0","type":"link"}