{"product_id":"proteintech-67404-1-ig","title":"Proteintech, 67404-1-Ig, VPS54 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS54 (67404-1-Ig) by Proteintech is a Monoclonal antibody targeting VPS54 in WB, IHC, ELISA applications with reactivity to Human, Pig, Mouse, Rat samples\n67404-1-Ig targets VPS54 in WB, IHC, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, pig brain tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVPS54 is a part of the Golgi-associated retrograde protein (GARP) complex protein required for tethering and fusion of endosome-derived transport vesicles to the trans-Golgi network. It may particpate in retrograde transport from early and late endosomes to the late Golgi. The GARP complex is required for the maintenance of the cycling of mannose 6-phosphate receptors between the TGN and endosomes, this cycling is necessary for proper lysosomal sorting of acid hydrolases such as CTSD.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Pig, Mouse, Rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4123 Product name: Recombinant human VPS54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 746-965 aa of BC030275 Sequence: CVDNIPSVTTDMLTRLSDLLKYFNSRSCQLVLGAGALQVVGLKTITTKNLALSSRCLQLIVHYIPVIRAHFEARLPPKQYSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSACFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR Predict reactive species\nFull Name: vacuolar protein sorting 54 homolog (S. cerevisiae)\nCalculated Molecular Weight: 977 aa, 111 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC030275\nGene Symbol: VPS54\nGene ID (NCBI): 51542\nRRID: AB_2882645\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9P1Q0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888336294057,"sku":"67404-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67404-1-ig","provider":"Iright","version":"1.0","type":"link"}