{"product_id":"proteintech-67414-1-ig","title":"Proteintech, 67414-1-Ig, GRIM19 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRIM19 (67414-1-Ig) by Proteintech is a Monoclonal antibody targeting GRIM19 in WB, IHC, ELISA applications with reactivity to human samples\n67414-1-Ig targets GRIM19 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HEK-293 cells,  HeLa cells,  HepG2 cells\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRIM19(Gene associated with retinoic and interferon-induced mortality 19 protein) is also named as NDUFA13 ,CI-B16.6 and belongs to the complex I NDUFA13 subunit family.t GRIM-19 may distribute in the mitochondria and\/or nucleus depending on the cell type.Alternatively, its cellular localization may be regulated by post-translational modifications such as phosphorylation and acetylation. Lastly, GRIM-19 may exist in different isoforms that may be distributed in distinct cellular locations(PMID:12628925).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag20855 Product name: Recombinant human GRIM19 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-144 aa of BC009189 Sequence: MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13\nCalculated Molecular Weight: 16.5 kDa\nObserved Molecular Weight: 16-18 kDa\nGenBank Accession Number: BC009189\nGene Symbol: GRIM19\nGene ID (NCBI): 51079\nRRID: AB_2882654\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9P0J0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888281473193,"sku":"67414-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67414-1-ig","provider":"Iright","version":"1.0","type":"link"}