{"product_id":"proteintech-67440-1-ig","title":"Proteintech, 67440-1-Ig, PPM1D Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPM1D (67440-1-Ig) by Proteintech is a Monoclonal antibody targeting PPM1D in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat, Pig samples\n67440-1-Ig targets PPM1D in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HEK-293 cells,  U2OS cells,  pig brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPM1D (also known as PP2Cd and WIP1) is a member of the PPM family, which is characterized by Mg2+\/Mn2+-dependent activity and relative insensitivity to okadaic acid. The PPM1D gene is aberrantly amplified in a range of common cancers and encodes a protein phosphatase that is a potential therapeutic target (PMID: 17700519). This antibody can be detected two bands of 47 and 67 Kda.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Pig\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24761 Product name: Recombinant human PPM1D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 254-423 aa of BC060877 Sequence: NGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPQQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVKSLE Predict reactive species\nFull Name: protein phosphatase 1D magnesium-dependent, delta isoform\nObserved Molecular Weight: 67 kDa, 47 kDa\nGenBank Accession Number: BC060877\nGene Symbol: PPM1D\nGene ID (NCBI): 8493\nRRID: AB_2882676\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O15297\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888071561385,"sku":"67440-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67440-1-ig","provider":"Iright","version":"1.0","type":"link"}