{"product_id":"proteintech-67443-1-ig","title":"Proteintech, 67443-1-Ig, MTH1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTH1 (67443-1-Ig) by Proteintech is a Monoclonal antibody targeting MTH1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n67443-1-Ig targets MTH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells\nPositive IHC detected in: human renal cell carcinoma tissue, mouse testis tissue,  human colon cancer tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMTH1, also known as NUDT1 or 8-Oxo-dGTPase, is an important repair enzyme that prevents oxidative stress-induced DNA damage through hydrolyzing mutagenic 8-oxo-dGTP into 8-oxo-dGMP. MTH1 is expressed in postmitotic neurons as well as in proliferative tissues, and it is localized both in the mitochondria and nucleus. MTH1 might be a useful marker of oxidative stress and its level increased upon oxidative stress. Increased expression of MTH1 were also found in various cancer tissues and neurodegenerative diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9802 Product name: Recombinant human NUDT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-179 aa of BC014618 Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV Predict reactive species\nFull Name: nudix (nucleoside diphosphate linked moiety X)-type motif 1\nCalculated Molecular Weight: 179aa,20 kDa; 197aa,23 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC014618\nGene Symbol: MTH1\nGene ID (NCBI): 4521\nRRID: AB_2882678\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P36639\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888068055209,"sku":"67443-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67443-1-ig","provider":"Iright","version":"1.0","type":"link"}