{"product_id":"proteintech-67491-1-ig","title":"Proteintech, 67491-1-Ig, PRKACA Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRKACA (67491-1-Ig) by Proteintech is a Monoclonal antibody targeting PRKACA in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples\n67491-1-Ig targets PRKACA in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, HeLa cells,  LNCaP cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  Pig liver tissue\nPositive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRKACA, also named as PKACA and PKA C-alpha, belongs to the protein kinase superfamily. AGC Ser\/Thr protein kinase family and cAMP subfamily. It phosphorylates a large number of substrates in the cytoplasm and the nucleus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26400 Product name: Recombinant human PRKACA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 162-351 aa of BC039846 Sequence: DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF Predict reactive species\nFull Name: protein kinase, cAMP-dependent, catalytic, alpha\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 38-43 kDa\nGenBank Accession Number: BC039846\nGene Symbol: PRKACA\nGene ID (NCBI): 5566\nRRID: AB_2882716\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P17612\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888032338089,"sku":"67491-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67491-1-ig","provider":"Iright","version":"1.0","type":"link"}