{"product_id":"proteintech-67494-1-ig","title":"Proteintech, 67494-1-Ig, ASC\/TMS1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASC\/TMS1 (67494-1-Ig) by Proteintech is a Monoclonal antibody targeting ASC\/TMS1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n67494-1-Ig targets ASC\/TMS1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, human placenta tissue,  THP-1 cells,  U-937 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, THP-1 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPYCARD , also known as ASC or TMS1, is a 195 amino acid protein containing an N-terminal Pyrin-like domain (PYD) and an 87 residue C-terminal Caspase-associated recruitment domain (CARD). It promotes caspase-mediated apoptosis which is mediated predominantly through the activation of caspase-9.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28424 Product name: Recombinant human TMS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-135 aa of BC004470 Sequence: MGRARDAILDALENLTAEELKKFKLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS Predict reactive species\nFull Name: PYD and CARD domain containing\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: BC004470\nGene Symbol: ASC\/TMS1\nGene ID (NCBI): 29108\nRRID: AB_2882718\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9ULZ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887981514921,"sku":"67494-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67494-1-ig","provider":"Iright","version":"1.0","type":"link"}