{"product_id":"proteintech-67522-1-ig","title":"Proteintech, 67522-1-Ig, SALL2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SALL2 (67522-1-Ig) by Proteintech is a Monoclonal antibody targeting SALL2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n67522-1-Ig targets SALL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, NCCIT cells,  Jurkat cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSall2 (SALL2, sal-like 2, HSAL2, p150(Sal2)) are mammalian homologs of the Drosophila region-specific home-otic gene spalt (sal), which encodes a zinc finger-\n\ncontaining transcription regulator. Mammalian Sall1 may mediate higher order chromatin structure and may be a component of a distinct heterochromatin-dependent \n\nsilencing process. Sall2 is a p53-independent regulator of p21 and BAX, and can function in some cell types as a regulator of cell survival. Human Sall2 is \n\npresent in brain, heart, kidney and pancreas.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30007 Product name: Recombinant human SALL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-198 aa of BC024245 Sequence: MAHESERSSRLGVPCGEPAELGGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATEPVCGIPVKWPAHEALEFQLHLHYHSKPGPTSAVWPRNCGWEGASNNGIQGSQGEDSPPPISASCTQGSA Predict reactive species\nFull Name: sal-like 2 (Drosophila)\nCalculated Molecular Weight: 1007 aa, 105 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC024245\nGene Symbol: SALL2\nGene ID (NCBI): 6297\nRRID: AB_2882742\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y467\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888321417385,"sku":"67522-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67522-1-ig","provider":"Iright","version":"1.0","type":"link"}