{"product_id":"proteintech-67530-1-ig","title":"Proteintech, 67530-1-Ig, SLC2A9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC2A9 (67530-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC2A9 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n67530-1-Ig targets SLC2A9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SMMC-7721 cells, pig liver tissue,  HepG2 cells,  L02 cells,  HuH-7 cells,  rat liver tissue,  mouse liver tissue,  rabbit liver tissue,  HSC-T6 cells\nPositive IHC detected in: human liver tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human hepatocirrhosis tissue, human kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24135 Product name: Recombinant human SLC2A9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 443-511 aa of BC018897 Sequence: IQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP Predict reactive species\nFull Name: solute carrier family 2 (facilitated glucose transporter), member 9\nCalculated Molecular Weight: 540 aa, 59 kDa\nObserved Molecular Weight: 56-59 kDa\nGenBank Accession Number: BC018897\nGene Symbol: SLC2A9\nGene ID (NCBI): 56606\nRRID: AB_2882749\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9NRM0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887991312553,"sku":"67530-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67530-1-ig","provider":"Iright","version":"1.0","type":"link"}