{"product_id":"proteintech-67570-1-ig","title":"Proteintech, 67570-1-Ig, MRE11 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRE11 (67570-1-Ig) by Proteintech is a Monoclonal antibody targeting MRE11 in WB, ELISA applications with reactivity to human, mouse, rat samples\n67570-1-Ig targets MRE11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  PC-12 cells,  NIH\/3T3 cells,  4T1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:3000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMre11 (meiotic recombination 11), also named as Mre11A, is a component of the MRN( MRE11\/RAD50\/NBS1) complex which is a versatile complex, playing a key role in the sensing, processing, and repair of DSBs. MRE11 possesses both endonuclease and 3'-5' exonuclease activity. It contains two DNA-binding domains (DBDs), enabling it to bind both single-stranded DNA (ssDNA) and double-stranded DNA (dsDNA). After DSBs, MRE11 is loaded onto DSBs sites and cleaves DNA by cooperating with CtIP (CtBP [C terminal binding protein] interacting protein) to initiate end resection. It's reported that MRE11 is over-expressed in breast cancers. (PMID:38128537; 22914783)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28847 Product name: Recombinant human MRE11A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 170-400 aa of BC063458 Sequence: QKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFR Predict reactive species\nFull Name: MRE11 meiotic recombination 11 homolog A (S. cerevisiae)\nObserved Molecular Weight: 81 kDa\nGenBank Accession Number: BC063458\nGene Symbol: MRE11A\nGene ID (NCBI): 4361\nRRID: AB_2882784\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P49959\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888294547625,"sku":"67570-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67570-1-ig","provider":"Iright","version":"1.0","type":"link"}