{"product_id":"proteintech-67576-1-ig","title":"Proteintech, 67576-1-Ig, TGIF2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TGIF2 (67576-1-Ig) by Proteintech is a Monoclonal antibody targeting TGIF2 in WB, FC (Intra), ELISA applications with reactivity to human samples\n67576-1-Ig targets TGIF2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, THP-1 cells,  COLO 320 cells,  Ramos cells,  Daudi cells,  K-562 cells,  Jurkat cells,  HL-60 cells,  MOLT-4 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTGIF2, is a member of a subfamily of transcription factor with a TALE(3-amino acid loop extension), an atypical homeodomain. It also contains a proline-rich region, which is a putative SH3 domain-binding site and suggested involve in transcriptional regulation. It is highly expressed in the heart, kidney, and testis, but low in the brain and prostate. Through binding directly to the 5'-CTGTCAA-3' DNA sequence or by interacting with TGF-beta activated SMAD proteins, TGIF2 acts as a transcriptional repressor. The calculated molecular weight of TGIF2 is 26 kDa, but the phosphorylated TGIF2 is about 30-35 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30083 Product name: Recombinant human TGIF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-237 aa of BC012816 Sequence: MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ Predict reactive species\nFull Name: TGFB-induced factor homeobox 2\nCalculated Molecular Weight: 237 aa, 26 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC012816\nGene Symbol: TGIF2\nGene ID (NCBI): 60436\nRRID: AB_2882789\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9GZN2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888077983913,"sku":"67576-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67576-1-ig","provider":"Iright","version":"1.0","type":"link"}