{"product_id":"proteintech-67583-1-ig","title":"Proteintech, 67583-1-Ig, HINT1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HINT1 (67583-1-Ig) by Proteintech is a Monoclonal antibody targeting HINT1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n67583-1-Ig targets HINT1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHINT1(Histidine triad nucleotide-binding protein 1) is also named as HINT, PKCI1, PRKCNH1,which is a member of the histidine triad (HIT) family, highly conserved in diverse species and ubiquitously expressed in mammalian tissues.It hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16662 Product name: Recombinant human HINT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-126 aa of BC007090 Sequence: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG Predict reactive species\nFull Name: histidine triad nucleotide binding protein 1\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC007090\nGene Symbol: HINT1\nGene ID (NCBI): 3094\nRRID: AB_2882793\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P49773\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888064385193,"sku":"67583-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67583-1-ig","provider":"Iright","version":"1.0","type":"link"}