{"product_id":"proteintech-67588-1-ig","title":"Proteintech, 67588-1-Ig, UBAP2L Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBAP2L (67588-1-Ig) by Proteintech is a Monoclonal antibody targeting UBAP2L in WB, ELISA applications with reactivity to human samples\n67588-1-Ig targets UBAP2L in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, K-562 cells,  LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquitin-associated protein 2-like (UBAP2L) is a highly conserved protein with an N-terminal ubiquitin-associated (UBA) domain involved in the ubiquitin-proteasome system and aggregate formation induced by proteasome inhibitors. It was originally identified as a human sperm protein that interacts with zona pellucida 3 in human eggs. It can interact with BIM1 to form a complex that modulates hematopoietic stem cell activity. Recent studies have confirmed that UBAP2L function as an oncogene and is associated with various types of cancer, including prostate cancer, glioma, hepatocellular carcinoma (HCC), and colorectal carcinoma. (PMID: 31114027, PMID: 29196913)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30125 Product name: Recombinant human UBAP2L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 330-488 aa of BC003170 Sequence: GNTFSHHSMVSMLGKGFGDVGEAKGGSTTGSQFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYDLKNPSDSAVHSPFTKRQAFTPSSTMMEVFLQEKSPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAHQKLKQQ Predict reactive species\nFull Name: ubiquitin associated protein 2-like\nCalculated Molecular Weight: 115 kDa\nObserved Molecular Weight: 140-160 kDa\nGenBank Accession Number: BC003170\nGene Symbol: UBAP2L\nGene ID (NCBI): 9898\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14157\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888334229673,"sku":"67588-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67588-1-ig","provider":"Iright","version":"1.0","type":"link"}