{"product_id":"proteintech-67627-1-ig","title":"Proteintech, 67627-1-Ig, CD24 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD24 (67627-1-Ig) by Proteintech is a Monoclonal antibody targeting CD24 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n67627-1-Ig targets CD24 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, Raji cells,  Ramos cells,  Daudi cells,  Jurkat cells,  K-562 cells,  HL-60 cells\nPositive IF\/ICC detected in: Daudi cells\nPositive FC (Intra) detected in: Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It  is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa.  (Ref: Akihiko Sano, MD., 2009)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11679 Product name: Recombinant human CD24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-80 aa of BC007674 Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS Predict reactive species\nFull Name: CD24 molecule\nCalculated Molecular Weight: 8 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC007674\nGene Symbol: CD24\nGene ID (NCBI): 100133941\nRRID: AB_2882828\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P25063\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888019165353,"sku":"67627-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67627-1-ig","provider":"Iright","version":"1.0","type":"link"}