{"product_id":"proteintech-67635-1-ig","title":"Proteintech, 67635-1-Ig, SLC25A17 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A17 (67635-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC25A17 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n67635-1-Ig targets SLC25A17 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, U2OS cells,  A549 cells,  HeLa cells,  HepG2 cells,  K-562 cells,  Jurkat cells\nPositive IHC detected in: human liver cancer tissue, human liver tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC25A17 (solute carrier family 25 member 17), is a kind of peroxisomal transporter for multiple cofactors such as CoA, FAD, FMN and AMP. It May catalyze the transport of free CoA, FAD and NAD+ from the cytosol into the peroxisomal matrix by a counter-exchange mechanism. SLC25A17 is the only member of the mitochondrial carrier family localized to peroxisomal. (PMID: 22185573, 32266253)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24456 Product name: Recombinant human SLC25A17 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 34-104 aa of BC012998 Sequence: RLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKD Predict reactive species\nFull Name: solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17\nCalculated Molecular Weight: 307 aa, 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC012998\nGene Symbol: SLC25A17\nGene ID (NCBI): 10478\nRRID: AB_2882836\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O43808\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888324366505,"sku":"67635-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67635-1-ig","provider":"Iright","version":"1.0","type":"link"}