{"product_id":"proteintech-67640-1-ig","title":"Proteintech, 67640-1-Ig, PHLPP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHLPP1 (67640-1-Ig) by Proteintech is a Monoclonal antibody targeting PHLPP1 in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n67640-1-Ig targets PHLPP1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HEK-293 cells,  pig brain tissue,  rat brain tissue,  rabbit brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPHLPP (PH domain leucine-rich-repeats protein phosphatase) belongs to a novel family of  Ser\/Thr protein phosphatases that consists of PHLPP1 and PHLPP2 isoforms. It has been shown that PHLPP negatively regulates multiple oncogenic pathways by directly dephosphorylating and inactivating key signaling molecules, including Akt, S6K, and RAF1. Observed MW of PHLPP1 beta is 185 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18982 Product name: Recombinant human PHLPP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1068-1204 aa of BC126277 Sequence: QQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKHHQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTP Predict reactive species\nFull Name: PH domain and leucine rich repeat protein phosphatase\nCalculated Molecular Weight: 185 kDa, 134 kDa\nObserved Molecular Weight: 185 kDa\nGenBank Accession Number: BC126277\nGene Symbol: PHLPP\nGene ID (NCBI): 23239\nRRID: AB_2882840\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O60346\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888031715497,"sku":"67640-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67640-1-ig","provider":"Iright","version":"1.0","type":"link"}