{"product_id":"proteintech-67645-1-ig","title":"Proteintech, 67645-1-Ig, GSTT1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSTT1 (67645-1-Ig) by Proteintech is a Monoclonal antibody targeting GSTT1 in WB, IHC, IF-P, ELISA applications with reactivity to Human, pig, mouse samples\n67645-1-Ig targets GSTT1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, pig, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig lung tissue, pig liver tissue,  K-562 cells,  rat liver tissue,  mouse brain tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGSTT1 belongs to the GST superfamily and Theta family. It is a conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. GSTT1 acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. It displays glutathione peroxidase activity with cumene hydroperoxide. GSTM1 and GSTT1 has been suggested as a risk factor in various cancers. GSTT1 is important in the detoxification of unidentified xenobiotics in the large intestine.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, pig, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8573 Product name: Recombinant human GSTT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-240 aa of BC007065 Sequence: MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR Predict reactive species\nFull Name: glutathione S-transferase theta 1\nCalculated Molecular Weight: 240 aa, 27 kDa\nObserved Molecular Weight: 28 kDa, 30 kDa\nGenBank Accession Number: BC007065\nGene Symbol: GSTT1\nGene ID (NCBI): 2952\nRRID: AB_2882845\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P30711\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888281571497,"sku":"67645-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67645-1-ig","provider":"Iright","version":"1.0","type":"link"}