{"product_id":"proteintech-67668-1-ig","title":"Proteintech, 67668-1-Ig, Ins1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Ins1 (67668-1-Ig) by Proteintech is a Monoclonal antibody targeting Ins1 in IHC, IF-P, ELISA applications with reactivity to mouse, rat samples\n67668-1-Ig targets Ins1 in IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse pancreas tissue, rat pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:2500-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\ninsulin I is  a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29988 Product name: Recombinant mouse insulin1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-87 aa of NM_008386 Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKR Predict reactive species\nFull Name: insulin I\nCalculated Molecular Weight: 12 kDa\nGenBank Accession Number: NM_008386\nGene Symbol: Ins1\nGene ID (NCBI): 16333\nRRID: AB_2882864\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P01325\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888065925289,"sku":"67668-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67668-1-ig","provider":"Iright","version":"1.0","type":"link"}