{"product_id":"proteintech-67672-1-ig","title":"Proteintech, 67672-1-Ig, DVL1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DVL1 (67672-1-Ig) by Proteintech is a Monoclonal antibody targeting DVL1 in WB, IHC, ELISA applications with reactivity to Human, rat, mouse samples\n67672-1-Ig targets DVL1 in WB, IHC, ELISA applications and shows reactivity with Human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, ROS1728 cells,  NCCIT cells,  HeLa cells,  MDA-MB-231 cells\nPositive IHC detected in: rat colon tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDVL1 is one of three DVL homologous proteins (DVL1-3) widely expressed in embryonic development and in the adult central nervous system. Dishevelled proteins are a necessary component of the Wnt and planar cell polarity developmental signaling pathways. Overexpression of DVL1 has been linked to prostate and breast cancers through the Wnt signaling pathway. There are two isoforms of DVL1: 75 kDa and 73 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26083 Product name: Recombinant human DVL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 283-416 aa of BC050454 Sequence: LGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELA Predict reactive species\nFull Name: dishevelled, dsh homolog 1 (Drosophila)\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC050454\nGene Symbol: DVL1\nGene ID (NCBI): 1855\nRRID: AB_2882868\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O14640\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888061239465,"sku":"67672-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67672-1-ig","provider":"Iright","version":"1.0","type":"link"}