{"product_id":"proteintech-67690-1-ig","title":"Proteintech, 67690-1-Ig, NDUFB8 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFB8 (67690-1-Ig) by Proteintech is a Monoclonal antibody targeting NDUFB8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n67690-1-Ig targets NDUFB8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  Jurkat cells,  HEK-293 cells,  4T1 cells,  HSC-T6 cells,  NIH\/3T3 cells,  pig brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6569 Product name: Recombinant human NDUFB8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-186 aa of BC000466 Sequence: MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 18-22 kDa\nGenBank Accession Number: BC000466\nGene Symbol: NDUFB8\nGene ID (NCBI): 4714\nRRID: AB_2882883\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O95169\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887996752041,"sku":"67690-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67690-1-ig","provider":"Iright","version":"1.0","type":"link"}