{"product_id":"proteintech-67698-1-ig","title":"Proteintech, 67698-1-Ig, YWHAZ Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe YWHAZ (67698-1-Ig) by Proteintech is a Monoclonal antibody targeting YWHAZ in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67698-1-Ig targets YWHAZ in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  PC-12 cells,  NIH3T3 cells,  RAW 264.7 cells\nPositive IHC detected in: human lung cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.2 μg per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYWHAZ (also known as 14-3-3 zeta) is a member of 14-3-3 proteins which were the first phosphoserine\/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgM\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6667 Product name: Recombinant human YWHAZ protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-245 aa of BC003623 Sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN Predict reactive species\nFull Name: tyrosine 3-monooxygenase\/tryptophan 5-monooxygenase activation protein, zeta polypeptide\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC003623\nGene Symbol: YWHAZ\nGene ID (NCBI): 7534\nRRID: AB_2882890\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Caprylic acid\/ammonium sulfate precipitation\nUNIPROT ID: P63104\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888337047721,"sku":"67698-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67698-1-ig","provider":"Iright","version":"1.0","type":"link"}