{"product_id":"proteintech-67700-1-ig","title":"Proteintech, 67700-1-Ig, SLC6A12 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC6A12 (67700-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC6A12 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67700-1-Ig targets SLC6A12 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, rat liver tissue,  HSC-T6 cells,  HuH-7 cells,  HepG2 cells,  mouse hepatocytes\nPositive IF\/ICC detected in: Caco-2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.2 μg per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, canine\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18962 Product name: Recombinant human SLC6A12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 548-614 aa of BC126215 Sequence: VCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL Predict reactive species\nFull Name: solute carrier family 6 (neurotransmitter transporter, betaine\/GABA), member 12\nCalculated Molecular Weight: 614 aa, 69 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC126215\nGene Symbol: SLC6A12\nGene ID (NCBI): 6539\nRRID: AB_2882892\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P48065\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888033616041,"sku":"67700-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67700-1-ig","provider":"Iright","version":"1.0","type":"link"}