{"product_id":"proteintech-67711-1-ig","title":"Proteintech, 67711-1-Ig, NARS Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NARS (67711-1-Ig) by Proteintech is a Monoclonal antibody targeting NARS in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n67711-1-Ig targets NARS in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HepG2 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells,  RAW 264.7 cells\nPositive IHC detected in: human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAsparagine-tRNA ligase (NARS) belongs to the class-II aminoacyl-tRNA synthetase family. Catalyzes the attachment of asparagine to tRNA(Asn) in a two-step reaction: asparagine is first activated by ATP to form Asn-AMP and then transferred to the acceptor end of tRNA(Asn) (PubMed: 9421509). In addition to its essential role in protein synthesis, acts as a signaling molecule that induced migration of CCR3-expressing cells. The NARS levels were higher in tumor tissues compared with adjacent normal tissues, and positively associated with LN metastasis. NARS may serve as a potential biomarker for lung adenocarcinoma (ADC) diagnosis\/prognosis (PMID: 27161446).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6656 Product name: Recombinant human NARS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 199-548 aa of BC001687 Sequence: ELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP Predict reactive species\nFull Name: asparaginyl-tRNA synthetase\nCalculated Molecular Weight: 63 kDa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: BC001687\nGene Symbol: NARS\nGene ID (NCBI): 4677\nRRID: AB_2882901\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O43776\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888301658281,"sku":"67711-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67711-1-ig","provider":"Iright","version":"1.0","type":"link"}