{"product_id":"proteintech-67712-1-ig","title":"Proteintech, 67712-1-Ig, EPRS Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPRS (67712-1-Ig) by Proteintech is a Monoclonal antibody targeting EPRS in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n67712-1-Ig targets EPRS in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, HeLa cells,  HSC-T6 cells,  NIH\/3T3 cells,  PC-12 cells,  HEK-293 cells,  HepG2 cells,  LNCaP cells,  Jurkat cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, BV-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman EPRS is a 172 kDa, 1512 amino acid polypeptide consisting of three major domains. The N and C termini contain ERS and PRS catalytic domains, respectively, joined by a 300 amino acid linker containing three tandem WHEP-TRS (referred to as WHEP) domains. EPRS is a bifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. EPRS has a special role in GAIT-mediated translational control, as it is solely responsible for recognition and interaction with GAIT elements in target mRNAs. (PMID: 29576217, PMID: 22386318, PMID: 19647514)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19184 Product name: Recombinant human EPRS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1163-1512 aa of BC126275 Sequence: RTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY Predict reactive species\nFull Name: glutamyl-prolyl-tRNA synthetase\nCalculated Molecular Weight: 1512 aa, 171 kDa\nObserved Molecular Weight: 171 kDa\nGenBank Accession Number: BC126275\nGene Symbol: EPRS\nGene ID (NCBI): 2058\nRRID: AB_2882902\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P07814\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888027685033,"sku":"67712-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67712-1-ig","provider":"Iright","version":"1.0","type":"link"}