{"product_id":"proteintech-67722-1-ig","title":"Proteintech, 67722-1-Ig, GATA2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GATA2 (67722-1-Ig) by Proteintech is a Monoclonal antibody targeting GATA2 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n67722-1-Ig targets GATA2 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HUVEC cells,  LNCaP cells,  PC-12 cells,  HepG2 cells,  HEK-293 cells,  K-562 cells,  NIH\/3T3 cells,  bEnd.3 cells\nPositive IF\/ICC detected in: SH-SY5Y cells\nPositive FC (Intra) detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGATA2 is a member of GATA family of transcription factors that contains zinc fingers in DNA binding domain. GATA2 acts as a transcriptinal activator that regulates endothelin-1 expression in endothelial cells. Together with GATA3, GATA2 regulates adipocyte differentiation through molecular control of the preadpocyte-adipocyte transition. It also affect the activity of Rho inhibitor p190RhoGAP that controls capillary network formation in vitro and retinal angiogenesis in vivo.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1557 Product name: Recombinant human GATA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 168-467 aa of BC018988 Sequence: SHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG Predict reactive species\nFull Name: GATA binding protein 2\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC018988\nGene Symbol: GATA2\nGene ID (NCBI): 2624\nENSEMBL Gene ID: ENSG00000179348\nRRID: AB_2882909\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P23769\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888042365097,"sku":"67722-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67722-1-ig","provider":"Iright","version":"1.0","type":"link"}