{"product_id":"proteintech-67724-1-ig","title":"Proteintech, 67724-1-Ig, ILK Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ILK (67724-1-Ig) by Proteintech is a Monoclonal antibody targeting ILK in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples\n67724-1-Ig targets ILK in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, human placenta tissue,  human peripheral blood platelets,  rat colon tissue,  mouse colon tissue,  pig colon tissue,  HepG2 cells,  HeLa cells,  HEK-293 cells,  K-562 cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nILK(Integrin-linked protein kinase) is also named as p59, PAT-4, DKFZp686F1765, ILK-1, ILK-2, ILK1, ILK2, p59ILK and belongs to the TKL Ser\/Thr protein kinase family. This protein localizes to multiple sites, including the cytoplasm, and imports into the nucleus through sequences in its N-terminus, via active transport mechanisms that involve nuclear pore complexes(PMID: 18635968). ILK performs crucial roles in the control of intestinal cell and crypt-villus axis homeostasis-especially with regard to basement membrane fibronectin deposition-as well as cell proliferation, spreading, and migration(PMID:19885839).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21289 Product name: Recombinant human ILK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 102-451 aa of BC001554 Sequence: VPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD Predict reactive species\nFull Name: integrin-linked kinase\nCalculated Molecular Weight: 451 aa, 59 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC001554\nGene Symbol: ILK\nGene ID (NCBI): 3611\nRRID: AB_2882910\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13418\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888043643049,"sku":"67724-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67724-1-ig","provider":"Iright","version":"1.0","type":"link"}