{"product_id":"proteintech-67725-1-ig","title":"Proteintech, 67725-1-Ig, WWOX Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe WWOX (67725-1-Ig) by Proteintech is a Monoclonal antibody targeting WWOX in WB, IHC, ELISA applications with reactivity to Human, rat, pig, mouse samples\n67725-1-Ig targets WWOX in WB, IHC, ELISA applications and shows reactivity with Human, rat, pig, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HeLa cells,  HEK-293 cells,  HepG2 cells,  pig liver tissue,  rat liver tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWWOX(WW domain-containing oxidoreductase) is also named as FOR, WOX1 and belongs to the short-chain dehydrogenases\/reductases (SDR) family. The gene encodes a 46 kDa protein that contains two WW domains and a short-chain dehydrogenase\/reductase domain and the protein is lost or reduced in the majority of many cancer types including breast, prostate, esophageal, lung, stomach, and pancreatic carcinomas and in a large fraction of other cancer types(PMID:17360458). WWOX behaves as a potential tumor-suppressor gene(PMID:15064722). It has 7 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, pig, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7969 Product name: Recombinant human WWOX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-234 aa of BC003184 Sequence: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG Predict reactive species\nFull Name: WW domain containing oxidoreductase\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC003184\nGene Symbol: WWOX\nGene ID (NCBI): 51741\nRRID: AB_2882911\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NZC7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888336818345,"sku":"67725-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67725-1-ig","provider":"Iright","version":"1.0","type":"link"}