{"product_id":"proteintech-67728-1-ig","title":"Proteintech, 67728-1-Ig, TXNRD1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TXNRD1 (67728-1-Ig) by Proteintech is a Monoclonal antibody targeting TXNRD1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67728-1-Ig targets TXNRD1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HSC-T6 cells, A549 cells,  PC-12 cells,  NIH\/3T3 cells,  4T1 cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThioredoxin reductase-1 (TXNRD1) is uniquely capable of utilizing electrons from NADPH to recover the reduced state of TRX1. Interestingly, TXNRD1 is upregulated in many human malignancies and promotes cancer progression, and attenuation of TXNRD1 levels effectively suppresses the growth of tumor cells (PMID: 31384178). TXNRD1 is also upregulated in many human malignancies and functions as a prognostic factor for many tumors, such as oral squamous cell carcinomas, lung cancer, breast cancer, and astrocytomas. TXNRD1 protein levels were analyzed by inmmunoblotting. Bands of ~55 kDa for TXNRD1 were observed. IHC analysis suggested TXNRD1 was mainly located in the cytoplasm. (PMID: 28536696, PMID: 20584310)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, chicken\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30071 Product name: Recombinant human TXNRD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 199-500 aa of BC018122 Sequence: SYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG Predict reactive species\nFull Name: thioredoxin reductase 1\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 50-70 kDa\nGenBank Accession Number: BC018122\nGene Symbol: TXNRD1\nGene ID (NCBI): 7296\nRRID: AB_2882914\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q16881\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887990984873,"sku":"67728-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67728-1-ig","provider":"Iright","version":"1.0","type":"link"}