{"product_id":"proteintech-67748-1-ig","title":"Proteintech, 67748-1-Ig, PSMB9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMB9 (67748-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMB9 in WB, IHC, ELISA applications with reactivity to human, rat samples\n67748-1-Ig targets PSMB9 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, rat spleen tissue,  Ramos cells,  Daudi cells,  HL-60 cells,  THP-1 cells\nPositive IHC detected in: human colon cancer tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMB9, also named as LMP2, PSMB6i and RING12, belongs to the peptidase T1B family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. High expression of PSMB9 associated with the poor prognosis of patients with NPC.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6802 Product name: Recombinant human PSMB9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-219 aa of BC065513 Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE Predict reactive species\nFull Name: proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 20-23 kDa\nGenBank Accession Number: BC065513\nGene Symbol: PSMB9\nGene ID (NCBI): 5698\nRRID: AB_2918517\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P28065\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888315125929,"sku":"67748-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67748-1-ig","provider":"Iright","version":"1.0","type":"link"}