{"product_id":"proteintech-67798-1-ig","title":"Proteintech, 67798-1-Ig, CNOT4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNOT4 (67798-1-Ig) by Proteintech is a Monoclonal antibody targeting CNOT4 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n67798-1-Ig targets CNOT4 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U2OS cells,  MCF-7 cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells.\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human colon cancer tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCNOT4, also known as CCR4-NOT transcription complex subunit 4 , has E3 ubiquitin ligase activity, and promotes ubiquitination and degradation of target proteins. CNOT4 is involved in activation of the JAK\/STAT pathway. CNOT4 exist many isoforms and the range of its molecular weight from 48 to 84 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29964 Product name: Recombinant human CNOT4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 273-572 aa of BC035590 Sequence: IDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA Predict reactive species\nFull Name: CCR4-NOT transcription complex, subunit 4\nCalculated Molecular Weight: 575 aa, 64 kDa\nObserved Molecular Weight: 64-85 kDa\nGenBank Accession Number: BC035590\nGene Symbol: CNOT4\nGene ID (NCBI): 4850\nRRID: AB_2918562\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O95628\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888059502761,"sku":"67798-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67798-1-ig","provider":"Iright","version":"1.0","type":"link"}