{"product_id":"proteintech-67809-1-ig","title":"Proteintech, 67809-1-Ig, PPP2CA Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP2CA (67809-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP2CA in WB, IHC, ELISA applications with reactivity to Human, rat samples\n67809-1-Ig targets PPP2CA in WB, IHC, CoIP, ELISA applications and shows reactivity with Human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, U2OS cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  HSC-T6 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPP2CA, also named as RP-C and PP2A-alpha, belongs to the PPP phosphatase family and PP-1 subfamily. PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. PP2A activity was modestly decreased in AML patients harboring C-KIT\/WT.PP2A is a target for C-KIT\/TKD and implicated the potential efficacy of therapies targeting PP2A in such AML in future.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4294 Product name: Recombinant human PPP2CA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-309 aa of BC031696 Sequence: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL Predict reactive species\nFull Name: protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform\nCalculated Molecular Weight: 309 aa, 36 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC031696\nGene Symbol: PPP2CA\nGene ID (NCBI): 5515\nRRID: AB_2918572\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P67775\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888048033961,"sku":"67809-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67809-1-ig","provider":"Iright","version":"1.0","type":"link"}