{"product_id":"proteintech-67822-1-ig","title":"Proteintech, 67822-1-Ig, VAMP2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAMP2 (67822-1-Ig) by Proteintech is a Monoclonal antibody targeting VAMP2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat, Pig, Rabbit samples\n67822-1-Ig targets VAMP2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rabbit brain tissue, pig brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-87 MG cells, SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Pig, Rabbit\nHost \/ Isotype: Mouse \/ IgG3\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17908 Product name: Recombinant human VAMP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-116 aa of BC002737 Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST Predict reactive species\nFull Name: vesicle-associated membrane protein 2 (synaptobrevin 2)\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC002737\nGene Symbol: VAMP2\nGene ID (NCBI): 6844\nRRID: AB_2918585\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P63027\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888079818921,"sku":"67822-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67822-1-ig","provider":"Iright","version":"1.0","type":"link"}