{"product_id":"proteintech-67832-1-ig","title":"Proteintech, 67832-1-Ig, PDE6A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDE6A (67832-1-Ig) by Proteintech is a Monoclonal antibody targeting PDE6A in WB, ELISA applications with reactivity to human, mouse, rat samples\n67832-1-Ig targets PDE6A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse eye tissue, rat eye tissue,  mouse retina tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDE6A(Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha) is also named as GMP-PDE alpha, PDE V-B1, PDEA and belongs to the cyclic nucleotide phosphodiesterase family. PDE6A contains an open reading frame capable of coding for a polypeptide of 859 amino acids and about 100 kDa. It is a subunit of a key phototransduction enzyme which participates in processes of transmission and amplification of the visual signal. The expression of PDE6 alpha in retina is essential for normal expression of PDE6 beta and PDE6 gama.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16741 Product name: Recombinant human PDE6A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-90 aa of BC035909 Sequence: MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVMKKLCFLLQ Predict reactive species\nFull Name: phosphodiesterase 6A, cGMP-specific, rod, alpha\nCalculated Molecular Weight: 860 aa, 100 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC035909\nGene Symbol: PDE6A\nGene ID (NCBI): 5145\nRRID: AB_2918594\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P16499\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888309031081,"sku":"67832-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67832-1-ig","provider":"Iright","version":"1.0","type":"link"}