{"product_id":"proteintech-67837-1-ig","title":"Proteintech, 67837-1-Ig, RAB1B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB1B (67837-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB1B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67837-1-Ig targets RAB1B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, NIH\/3T3 cells,  HeLa cells,  U2OS cells,  LNCaP cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells\nPositive IHC detected in: human lung cancer tissue, human liver cancer tissue,  human ovary tumor tissue,  human pancreas cancer tissue,  human stomach cancer tissue,  rat brain tissue,  rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12069 Product name: Recombinant human RAB1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC071169 Sequence: MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC Predict reactive species\nFull Name: RAB1B, member RAS oncogene family\nCalculated Molecular Weight: 201 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC071169\nGene Symbol: RAB1B\nGene ID (NCBI): 81876\nRRID: AB_2918599\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9H0U4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888316371113,"sku":"67837-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67837-1-ig","provider":"Iright","version":"1.0","type":"link"}