{"product_id":"proteintech-67851-1-ig","title":"Proteintech, 67851-1-Ig, RUVBL2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RUVBL2 (67851-1-Ig) by Proteintech is a Monoclonal antibody targeting RUVBL2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67851-1-Ig targets RUVBL2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRUVBL2 belongs to the conserved ATPases associated with various cellular activities (AAA+) protein subfamily, which is characterized by the presence of conserved Walker A and B motifs that are involved in ATP binding and hydrolysis. The AAA+ (ATPases associated with diverse cellular activities) ATPases, RUVBL1 and RUVBL2, were originally isolated as components of transcriptional complexes and shown to function in a number of different cellular processes, including transcriptional regulation, chromatin remodelling and DNA damage responses. (PMID: 31572066, PMID: 31138842)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0253 Product name: Recombinant human RUVBL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-463 aa of BC000428 Sequence: SQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS Predict reactive species\nFull Name: RuvB-like 2 (E. coli)\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC000428\nGene Symbol: RUVBL2\nGene ID (NCBI): 10856\nRRID: AB_2918610\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y230\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888074346665,"sku":"67851-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67851-1-ig","provider":"Iright","version":"1.0","type":"link"}