{"product_id":"proteintech-67877-1-ig","title":"Proteintech, 67877-1-Ig, PLEKHB2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLEKHB2 (67877-1-Ig) by Proteintech is a Monoclonal antibody targeting PLEKHB2 in WB, ELISA applications with reactivity to Human, pig samples\n67877-1-Ig targets PLEKHB2 in WB, ELISA applications and shows reactivity with Human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HT-29 cells,  COLO320 cells,  SW480 cells,  NCCIT cells,  BxPC-3 cells,  U-87 MG cells,  HL-60 cells,  Pig colon tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLEKHB2, also named as EVT2 (Evectin-2), is involved in retrograde transport of recycling endosomes. PLEKHB2 has been identified as post-Golgi proteins of unknown function that have a PH domain that typically binds polyphosphoinositides. PLEKHB2 is expressed in a broad range of tissues. PLEKHB2 has some isoforms with MW 19-26 kDa and 34 kDa. This antibody recognizes all the isoforms of PLEKHB2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9231 Product name: Recombinant human PLEKHB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC013991 Sequence: MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDL Predict reactive species\nFull Name: pleckstrin homology domain containing, family B (evectins) member 2\nCalculated Molecular Weight: 222 aa, 25 kDa\nObserved Molecular Weight: 19-25;30-34 kDa\nGenBank Accession Number: BC013991\nGene Symbol: PLEKHB2\nGene ID (NCBI): 55041\nRRID: AB_2918634\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q96CS7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888311390377,"sku":"67877-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67877-1-ig","provider":"Iright","version":"1.0","type":"link"}