{"product_id":"proteintech-67882-1-ig","title":"Proteintech, 67882-1-Ig, LPCAT3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LPCAT3 (67882-1-Ig) by Proteintech is a Monoclonal antibody targeting LPCAT3 in WB, IHC, ELISA applications with reactivity to human, pig samples\n67882-1-Ig targets LPCAT3 in WB, IHC, IF, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig stomach tissue, HepG2 cells\nPositive IHC detected in: human stomach tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLysophosphatidylcholine acyltransferases (LPCATs) are among the lysophopholipid acyltransferases (LPLATs) that play an important role in lipid metabolism and homeostasis by regulating the abundance of different phosphatidylcholine (PC) species. Lysophosphatidylcholine acyltransferase 3 (LPCAT3) is a member of the LPCAT family that primarily regulates the levels of arachidonic PC species. LPCAT3 is abundantly expressed in the testes, kidneys, and metabolic tissues, including the liver, intestine, and adipose tissues. LPCAT3 is involved in the occurrence and development of atherosclerosis, intestinal tumors, and nonalcoholic steatohepatitis (NASH)(PMID: 35711841).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6472 Product name: Recombinant human LPCAT3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 122-233 aa of BC065194 Sequence: MAYLLAGYYYTATGNYDIKWTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGFSYFYGAFLVGPQFSMNHYMKLVQGELIDIPGKIPNSIIPALKR Predict reactive species\nFull Name: lysophosphatidylcholine acyltransferase 3\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC065194\nGene Symbol: LPCAT3\nGene ID (NCBI): 10162\nRRID: AB_2918639\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q6P1A2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887983120553,"sku":"67882-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67882-1-ig","provider":"Iright","version":"1.0","type":"link"}