{"product_id":"proteintech-67892-1-ig","title":"Proteintech, 67892-1-Ig, KPNA3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe KPNA3 (67892-1-Ig) by Proteintech is a Monoclonal antibody targeting KPNA3 in WB, IHC, ELISA applications with reactivity to Human, rat, mouse samples\n67892-1-Ig targets KPNA3 in WB, IHC, IF, ELISA applications and shows reactivity with Human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HSC-T6 cells,  HepG2 cells,  HeLa cells,  Jurkat cells,  K-562 cells,  PC-12 cells,  NIH\/3T3 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1500-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nkaryopherin subunit alpha 3 (KPNA3) is a member of the importin alpha family which can transport molecules between the mucleus and cytoplasm. It is ubiquitous expressed in brain,testis and esophagus. KPNA3 is associated with many severe diseases such as hepatocellular Carcinoma (PMID: 31417635) , schizophrenia, major depression and opiate dependence (PMID: 22960338) . The molecular weight of KPNA3 is about 58 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27767 Product name: Recombinant human KPNA3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 322-453 aa of BC017355 Sequence: VLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEII Predict reactive species\nFull Name: karyopherin alpha 3 (importin alpha 4)\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC017355\nGene Symbol: KPNA3\nGene ID (NCBI): 3839\nRRID: AB_2918648\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O00505\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888029978793,"sku":"67892-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67892-1-ig","provider":"Iright","version":"1.0","type":"link"}