{"product_id":"proteintech-67903-1-ig","title":"Proteintech, 67903-1-Ig, MRPS25 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRPS25 (67903-1-Ig) by Proteintech is a Monoclonal antibody targeting MRPS25 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n67903-1-Ig targets MRPS25 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NIH\/3T3 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  PC-12 cells,  4T1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial ribosomal protein S25 (MRPS25) belongs to the ribosomal protein S25\/L51 family. It is a component of the mitochondrial ribosome small subunit (28S). The variant segregated with the disease and substitutes a highly conserved proline residue with leucine (p.P72L) that, based on the high-resolution structure of the 28S ribosome, is predicted to compromise inter-protein contacts and destabilize the small subunit.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7846 Product name: Recombinant human MRPS25 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-173 aa of BC003590 Sequence: MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD Predict reactive species\nFull Name: mitochondrial ribosomal protein S25\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC003590\nGene Symbol: MRPS25\nGene ID (NCBI): 64432\nRRID: AB_2918659\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P82663\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888067825833,"sku":"67903-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67903-1-ig","provider":"Iright","version":"1.0","type":"link"}