{"product_id":"proteintech-67907-1-ig","title":"Proteintech, 67907-1-Ig, EIF5A2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF5A2 (67907-1-Ig) by Proteintech is a Monoclonal antibody targeting EIF5A2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, rat samples\n67907-1-Ig targets EIF5A2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells\nPositive IHC detected in: human lung cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEukaryotic translation initiation factor 5A (EIF5A), a conserved lysine to hypusine, is strictly indispensable for the survival of eukaryotic cells. There are two EIF5A isoforms in humans: EIF5A1 and EIF5A2. EIF5A2 has been reported to be overexpressed in gallbladder cancer, upper urinary tract urothelial carcinoma, gastric cancer, prostate cancer, nasopharyngeal carcinoma, and cervical cancer. EIF5A2 upregulation in cancer tissues is associated with poor prognosis in these patients.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag10852 Product name: Recombinant human EIF5A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-153 aa of BC036072 Sequence: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK Predict reactive species\nFull Name: eukaryotic translation initiation factor 5A2\nCalculated Molecular Weight: 153 aa, 17 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC036072\nGene Symbol: EIF5A2\nGene ID (NCBI): 56648\nRRID: AB_2918663\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9GZV4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888061567145,"sku":"67907-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67907-1-ig","provider":"Iright","version":"1.0","type":"link"}