{"product_id":"proteintech-67912-1-ig","title":"Proteintech, 67912-1-Ig, PXR Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PXR (67912-1-Ig) by Proteintech is a Monoclonal antibody targeting PXR in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n67912-1-Ig targets PXR in WB, IHC, IF, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, COLO 320 cells,  MCF-7 cells,  mouse liver tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPregnane X receptor (PXR; NR1I2), a member of the nuclear receptor superfamily, plays a key  role in the induction of genes involved in drug transport and metabolism. It modulates drug transport and metabolism through the regulation of target genes responsible for the transport and conversion of chemicals into metabolites that are more easily eliminated from the body [PMID: 22609277]. It is also emerging as an endobiotic receptor that regulates the inflammatory response. In addition, PXR acts as a transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds [PMID: 19297428].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7991 Product name: Recombinant human PXR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 56-433 aa of BC017304 Sequence: MTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS Predict reactive species\nFull Name: nuclear receptor subfamily 1, group I, member 2\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC017304\nGene Symbol: PXR\nGene ID (NCBI): 8856\nRRID: AB_2918667\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O75469\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887989739689,"sku":"67912-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67912-1-ig","provider":"Iright","version":"1.0","type":"link"}