{"product_id":"proteintech-67926-1-ig","title":"Proteintech, 67926-1-Ig, FAM114A1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM114A1 (67926-1-Ig) by Proteintech is a Monoclonal antibody targeting FAM114A1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, rat, mouse samples\n67926-1-Ig targets FAM114A1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, PC-12 cells,  NIH\/3T3 cells,  A549 cells,  HepG2 cells,  LNCaP cells,  HeLa cells,  HSC-T6 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM114A1, also named as Nervous system overexpressed protein 20, is a 563 amino acid protein, which belongs to the FAM114 family. FAM114A1 localizes in the cytoplasm and may play a role in neuronal cell development. The calculated molecular weight of FAM114A1 is 61 kDa, but the modified FAM114A1 may be 70-80 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17289 Product name: Recombinant human FAM114A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 305-538 aa of BC040452 Sequence: LEILSNESESKVQSFLASLDGEKLELLKNDLISIKDIFAAKELENEENQEEQGLEEKGEEFARMLTELLFELHVAATPDKLNKAMKRAHDWVEEDQTVVSVDVAKVSEEETKKEEKEEKSQDPQEDKKEEKKTKTIEEVYMSSIESLAEVTARCIEQLHKVAELILHGQEEEKPAQDQAKVLIKLTTAMCNEVASLSKKFTNSLTTVGSNKKAEVLNPMISSVLLEGCNSTTYI Predict reactive species\nFull Name: family with sequence similarity 114, member A1\nCalculated Molecular Weight: 563 aa, 61 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC040452\nGene Symbol: FAM114A1\nGene ID (NCBI): 92689\nRRID: AB_2918678\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8IWE2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888062124201,"sku":"67926-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67926-1-ig","provider":"Iright","version":"1.0","type":"link"}