{"product_id":"proteintech-67929-1-ig","title":"Proteintech, 67929-1-Ig, SLC36A3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC36A3 (67929-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC36A3 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Mouse samples\n67929-1-Ig targets SLC36A3 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled mouse testis tissue, COLO 320 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16556 Product name: Recombinant human SLC36A3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 84-190 aa of BC101092 Sequence: VLTVHCMVILLNCAQHLSQRLQKTFVNYGEATMYGLETCPNTWLRAHAVWGRWNLALSPRLECSGKISAHCNPHLQGSSNSPAQASRVAGIYRYTVSFLLVITQLGF Predict reactive species\nFull Name: solute carrier family 36 (proton\/amino acid symporter), member 3\nCalculated Molecular Weight: 511 aa, 56 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC101092\nGene Symbol: SLC36A3\nGene ID (NCBI): 285641\nRRID: AB_2918681\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q495N2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888324726953,"sku":"67929-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67929-1-ig","provider":"Iright","version":"1.0","type":"link"}