{"product_id":"proteintech-67955-1-ig","title":"Proteintech, 67955-1-Ig, ABCC5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABCC5 (67955-1-Ig) by Proteintech is a Monoclonal antibody targeting ABCC5 in WB, ELISA applications with reactivity to Human, Rat samples\n67955-1-Ig targets ABCC5 in WB, ELISA applications and shows reactivity with Human, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, U2OS cells,  HEK-293 cells,  HeLa cells,  K-562 cells,  HSC-T6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nABCC5, also named as MOAT-C, pABC11, SMRP, and MRP5, belongs to the ABC transporter superfamily, ABCC family, and Conjugate transporter (TC 3.A.1.208) subfamily. ABCC5 acts as a multispecific organic anion pump that can transport nucleotide analogs. ABCC5 functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that ABCC5 provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl) adenine. ABCC5 may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Since it is glycosylated, the apparent molecular weight of ABCC5 could be variable, ranging from 161 kDa to 200 kDa (PMID: 10893247; PMID: 15897250; PMID: 31338999).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rat\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31674 Product name: Recombinant human ABCC5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-179 aa of NM_005688 Sequence: MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRL Predict reactive species\nFull Name: ATP-binding cassette, sub-family C (CFTR\/MRP), member 5\nCalculated Molecular Weight: 161 kDa\nObserved Molecular Weight: 180-200kDa\nGenBank Accession Number: NM_005688\nGene Symbol: ABCC5\nGene ID (NCBI): 10057\nRRID: AB_2918706\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O15440\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888051867817,"sku":"67955-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67955-1-ig","provider":"Iright","version":"1.0","type":"link"}